PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01406.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 810aa    MW: 90254.7 Da    PI: 6.3041
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01406.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23177278199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v
  Sme2.5_01406.1_g00008.1 177 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAV 261
                              99****************************86333.45679********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F   + +++ l+++++r+
  Sme2.5_01406.1_g00008.1 262 LFL--RGEGGDLRLGIRRA 278
                              ***..4489999**99986 PP

2Auxin_resp119.23.3e-39303384182
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                              +a+a+s k++F+v+Y+Pras+++Fvv+++k++ka+++++ vG+Rfkm+f+ +ds+err+sG+v+g+sd+dp+rWpnSkWr+L
  Sme2.5_01406.1_g00008.1 303 VATALSAKNTFHVFYSPRASHADFVVPYQKYVKAINTRIPVGTRFKMRFDLDDSPERRYSGVVTGISDMDPFRWPNSKWRCL 384
                              68999****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-44169294IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-40170290IPR015300DNA-binding pseudobarrel domain
CDDcd100174.01E-22175277No hitNo description
SMARTSM010193.8E-23177279IPR003340B3 DNA binding domain
PfamPF023622.4E-21177278IPR003340B3 DNA binding domain
PROSITE profilePS5086312.901177279IPR003340B3 DNA binding domain
PfamPF065071.2E-32304384IPR010525Auxin response factor
SuperFamilySSF542774.12E-11675761No hitNo description
PROSITE profilePS5174521.663682766IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MEIDLNHALV SEVEKNACCN NEECDKGGGG VCVNCSLYTS TTSSCSSNVS SSSSLAISSI  60
YMELWHACAG PLTSLPKKGN VVVYFPQGHM EEAVSAFSFS PVKIDFPTFG LQPQIFCRVE  120
DVQLLANKEN DEVYTQLTLL PLSESMTISL EGKEHEDSGT DEEANGVNPG KSASHMFCKT  180
LTASDTSTHG GFSVPRRAAE DCFPPLDYKE QRPSQELIAK DLHGVEWKFR HIYRGQPRRH  240
LLTTGWSIFV SQKNLVSGDA VLFLRGEGGD LRLGIRRAAR PRNGLPESII KSQYSRPDVL  300
SPVATALSAK NTFHVFYSPR ASHADFVVPY QKYVKAINTR IPVGTRFKMR FDLDDSPERR  360
YSGVVTGISD MDPFRWPNSK WRCLMVRWDE DIMSNHQERV SPWEIDSSVS LPPLSIQSSP  420
RLKKLRTSQQ APSVLDSHFA GGSALLDFEE SVRSSKVLQG QENLGLISPP YGCDKTVRPL  480
DFELQRAARH NLMPNGVENM IVGDFVKTQP PTTYTGFLES NRFPKVLQGQ EICSLRSLTG  540
KGDVNFGAWG KPEFGCNVFG TYQRPKANFY PLASEGARNV FLPYNAMYRT GQHPVVPSYI  600
TGFQRENPTL NQNSIQNVVR REEGGMPKFV NEQRPPEMSK VSIPENHFKN DDSLNAQASC  660
KLFGFSLTKE PSTPSSQSSG KRSCTKVHKQ GSLVGRAIDL SRLNGYDDLL VELERLFNME  720
DLLRDPNKGW RILYTDSEND MMVVGDDPWH EFCEVVSKIH IYTQEEVEKM TIEGISDDTQ  780
SCLEEAPAII DGSKSSSVGQ PDSSPTVIRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1146340622353Auxin response factor 1
4ldw_A1e-1146340622353Auxin response factor 1
4ldw_B1e-1146340622353Auxin response factor 1
4ldx_A1e-1146340622353Auxin response factor 1
4ldx_B1e-1146340622353Auxin response factor 1
4ldy_A1e-1146340622353Auxin response factor 1
4ldy_B1e-1146340622353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402590.0DQ340259.1 Lycopersicon esculentum auxin response factor 4 (ARF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015058398.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLM1AE600.0M1AE60_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000208390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4